PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002509
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family BBR-BPC
Protein Properties Length: 330aa    MW: 36645.3 Da    PI: 9.2921
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58687455PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-8227PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind354.91.7e-10813301301
  GAGA_bind   1 mdddgsre..rnkg.yye...pa.aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla. 92 
                md++g+re  r+k+ + +   ++ +s+k     q+m+++aerda+i+ernla+sekkaa+aerdma+lqrd+a+aern a++erdn++++l+++ens++ 
  Lsa002509   1 MDESGHREngRQKPpQGQwlmQHqPSMK-----QIMTIMAERDAAIQERNLAISEKKAALAERDMALLQRDSAIAERNTAIMERDNAITTLQYRENSMNn 95 
                8999998878888732222222234454.....****************************************************************999 PP

  GAGA_bind  93 ...........salpvgvqvlsgtksidslqq.lsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkak.kkkkksekskkkvk 179
                           s +p+g+q+++ +k++++ +  l++++++    +   ++    +p ++ ++ +ke+k + k+ +  ++k+k +    +k   ++ ++ +
  Lsa002509  96 snnnnnsnntpSPCPPGCQISRSVKHVHHPHAyLQHHEMGGGIGDSIPTSPPAPEPKSRRVKRVKETKPPAKKTSRMSKKVKMECdDLNKAMFEEPHDWN 195
                99*****999999****************99977777777766665555545555555555555555555544433333333332233443333333333 PP

  GAGA_bind 180 kesader...................skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKm 260
                      +                   +k+e+k++dl+ln+v++Dest+P+PvCsCtG+ r CYkWGnGGWqS+CCttt+S++PLP  +++r+aR++grKm
  Lsa002509 196 ------KggddsgggggggvddlnrgVKSEWKDQDLGLNHVAFDESTMPIPVCSCTGVFRPCYKWGNGGWQSSCCTTTMSMHPLPSLPNKRHARVGGRKM 289
                ......13334468999*********************************************************************************** PP

  GAGA_bind 261 SqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                S+++f+kl+++LaaeG+dlsnpvDLk+hWAkHGtn+++ti+
  Lsa002509 290 SGSVFNKLISRLAAEGHDLSNPVDLKEHWAKHGTNRYITIK 330
                ****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062177.2E-961330IPR010409GAGA-binding transcriptional activator
SMARTSM012265.1E-1491330IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MDESGHRENG RQKPPQGQWL MQHQPSMKQI MTIMAERDAA IQERNLAISE KKAALAERDM  60
ALLQRDSAIA ERNTAIMERD NAITTLQYRE NSMNNSNNNN NSNNTPSPCP PGCQISRSVK  120
HVHHPHAYLQ HHEMGGGIGD SIPTSPPAPE PKSRRVKRVK ETKPPAKKTS RMSKKVKMEC  180
DDLNKAMFEE PHDWNKGGDD SGGGGGGGVD DLNRGVKSEW KDQDLGLNHV AFDESTMPIP  240
VCSCTGVFRP CYKWGNGGWQ SSCCTTTMSM HPLPSLPNKR HARVGGRKMS GSVFNKLISR  300
LAAEGHDLSN PVDLKEHWAK HGTNRYITIK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083484.11e-166PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083485.11e-166PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083486.11e-166PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083487.11e-166PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083488.11e-166PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083489.11e-166PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083490.11e-166PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083491.11e-166PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083492.11e-166PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083493.11e-166PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083494.11e-166PREDICTED: protein BASIC PENTACYSTEINE6
SwissprotQ8L9991e-138BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLH1ZN700.0H1ZN70_CICIN; GAGA-binding transcriptional activator
STRINGGLYMA04G02860.11e-159(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-136basic pentacysteine 6